Scaffold Ga0193087_10103124

Overview

Basic Information

• Taxon OID: 3300018964
• Scaffold ID: Ga0193087_10103124
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 919
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_065
• Coordinates
  • Lat. (^o): -35.2421
  • Long. (^o): 26.3048
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012678	Metagenome / Metatranscriptome	278	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193087_101031241	F012678	GAG	MLNQHSLEEIAEIHNLLEDIKIEYEDGIKPILLKNSSTFFSNPHTVPKLKK