Scaffold Ga0193480_10128849

Overview

Basic Information

• Taxon OID: 3300018959
• Scaffold ID: Ga0193480_10128849
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789530-ERR1719318)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 823
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas commoda (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Pacific Ocean: TARA_135
• Coordinates
  • Lat. (^o): 32.9916
  • Long. (^o): -121.8536
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003454	Metatranscriptome	485	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193480_101288491	F003454	N/A	VRQALIISMSLSLLPLAFIGSVSAHGGVVYPPIWQAGASIPLDEIVNDDAFTDPPARDPNSGRAVKNVKSWLTDQAYTGGIGDQFKKEGPITNDKTNKNLRKWDRCGTNCMKYKNPWAAPGQAPTLGGGCGVFGGNPNGCPWGKDDRPAGSQCGQDEPLGRGGRGTSSFGTDARFYDFPDMITTEWEIGSVQEVAWSSKGGHRGGYTYRLCKMPKGGRTAITEDCFTKNVLEFATNFTMIKAIKNGKSEKGWEQFDQVDLREGTYPEGSVWRPV