Scaffold Ga0192892_10132881

Overview

Basic Information

• Taxon OID: 3300018950
• Scaffold ID: Ga0192892_10132881
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789413-ERR1719427)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 878
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean: TARA_068
• Coordinates
  • Lat. (^o): -31.0292
  • Long. (^o): 4.6742
  • Depth (m): 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030336	Metatranscriptome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0192892_101328811	F030336	N/A	MAAPTKFWGKWGALNPQWAKKFIEMSYNRGYAQPIATGRYAEYWEPGSRIAFYARRFDIDWLKIAAMRVDAARTPLIVLRRQIWLMRIEYWARKSKNFRHLYRAAKIEWAYIKTRVRQPFTWTGRDALHALFWLVQLFAGFCIGEVIGRETLLGYDVVDPSWQPVRPMFAPGFYHVHAGFDDNYPFEKHSSNLSRYFQRGYWPNTDNIYYCPNNKPLGIPHQSS