Scaffold Ga0193266_10046696

Overview

Basic Information

• Taxon OID: 3300018943
• Scaffold ID: Ga0193266_10046696
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789547-ERR1719206)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1297
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Pacific Ocean: TARA_093
• Coordinates
  • Lat. (^o): -34.0614
  • Long. (^o): -73.1066
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025045	Metatranscriptome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193266_100466961	F025045	N/A	LTTVKRRKRSADGVVVSEDENPMNNMIERVQDMYMAVLQSEECMERVACEVGGLAADAGISKSLTRASEAFLPKKYNKMMKNFNHGKDCSKNNKCGVF