Scaffold Ga0193304_1062575

Overview

Basic Information

• Taxon OID: 3300018888
• Scaffold ID: Ga0193304_1062575
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 715
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_102
• Coordinates
  • Lat. (^o): -5.2669
  • Long. (^o): -85.2732
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044292	Metatranscriptome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193304_10625751	F044292	N/A	LVFWSLVSLVRLGQAVPTFYLQGFPAVPVPAVQVYSVQDTQDVQQAKAEFMQEFQRALDGLLYELAPAPVKAEYLEDTADVKAAKTEFFRVFNDALNGIIATAYLDDTPEVKEAKEEFFKTFESAMNNLLTTVETSYLEDTPEVKEAKARFNQAYADAEEGRVGAQYIEDTPEVKAAKEGFFKYFDFVIGGFLDSLSPKPGHNVLPKEIASFYIADEQDVAEEKRKLDKIYLDAVNEL