Basic Information | |
---|---|
Taxon OID | 3300018877 Open in IMG/M |
Scaffold ID | Ga0193600_1127450 Open in IMG/M |
Source Dataset Name | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 42 hrs after wetting v1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | QB3 Vincent J. Coates Genomics Sequencing Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 583 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah, Colorado Plateau, Green Butte Site | |||||||
Coordinates | Lat. (o) | 38.712053 | Long. (o) | -109.695097 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073083 | Metagenome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193600_11274501 | F073083 | N/A | GDRVQVRSDGGSAAARKYAGKKGQVTMRGPGLDRIVVDVQLEENNFDTVFEEEDLSTTPDRDG |
⦗Top⦘ |