Scaffold Ga0193042_1146500

Overview

Basic Information

• Taxon OID: 3300018845
• Scaffold ID: Ga0193042_1146500
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 541
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: TARA_081
• Coordinates
  • Lat. (^o): -44.5582
  • Long. (^o): -52.2718
  • Depth (m): 35

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002856	Metatranscriptome	525	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193042_11465001	F002856	GGA	MAFRRNRSAIMVVLAAVAAVCAFFQASSAFLGPYLHQKTQGTTSDYFADVGYFTDGTSIIKAGNANNHPITAEDPHTNGSPLVASTYMADVGYFADGTSMIKAGNANNHPITATDPHTNGSPLPSSKYAAEVGYFVDGTDVTKAGNMNNR