Scaffold Ga0193219_1056766

Overview

Basic Information

• Taxon OID: 3300018842
• Scaffold ID: Ga0193219_1056766
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 602
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum micans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_046
• Coordinates
  • Lat. (^o): -0.6625
  • Long. (^o): 73.161
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050078	Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193219_10567662	F050078	AGG	MVMMEHIIEESKAEQADAIKSENDAVAAYADYIADSTTAIEGMQRSIINKSEELAKVDSKKAEAEADLQTNAADLLSLLKMYQTLHNDCDFLLKYFDVRQTKRAEEIE