Scaffold Ga0194240_1024645

Overview

Basic Information

• Taxon OID: 3300018832
• Scaffold ID: Ga0194240_1024645
• Source Dataset Name: Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 582
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Aculeata → Apoidea → Apidae → Apinae → Apini → Apis → Apis mellifera (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097456	Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194240_10246451	F097456	GAG	MADTKLTGTYKHQKNENYNDYLKALNMGWFKRKTAVSSSPIEKVMEGSAGTLNFKRICGINKTVEQTISLGEEHSETLPNGEVVRGITVREGDHNLITRLEHKKMGKMELIREFSKDGMVMY