Scaffold Ga0192949_1033882

Overview

Basic Information

• Taxon OID: 3300018831
• Scaffold ID: Ga0192949_1033882
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1043
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: TARA_082
• Coordinates
  • Lat. (^o): -47.1863
  • Long. (^o): -58.2902
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002472	Metatranscriptome	556	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0192949_10338821	F002472	N/A	VFGDVSLSKNQVREINGVQQNPGAGGWPTVRFFNKETGYGGKPYAKKTDQAMCDELGPKTEYMQMLVEELGGTSLCNVKSPDSGCSEKQQEFIKKWSDKPADEVQKQLARLQKMMDDGQGSAMKPDALTWVKHRIGIFKQLGGSKKDEL