Scaffold Ga0193075_1023983

Overview

Basic Information

• Taxon OID: 3300018814
• Scaffold ID: Ga0193075_1023983
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000047 (ERX1789515-ERR1719274)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1167
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Pelagomonas → Pelagomonas calceolata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_038
• Coordinates
  • Lat. (^o): 19.0284
  • Long. (^o): 64.5126
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056344	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193075_10239831	F056344	GGCGG	MDEGGFPCWHNTITNQRTWKRPARQKKAPPVFYAPSFGHLEGRSAFGTRPARNYVVGGDTVAAEPSNVGSMMAFLGVYYGILEWTQRRRKNVYRERLDAWKNLTRTLEHDFDGTQRPGSGQYCGDSIESDKGDQDVVTSLRFLSDGSVRGDGVDGKDGKYTLAGRWSGGRCAWIERYSDFEVAVDGWVKKGGDIFIRFCSSRGITGTVDLELLEAA