Scaffold Ga0193183_1055122

Overview

Basic Information

• Taxon OID: 3300018811
• Scaffold ID: Ga0193183_1055122
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 710
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_036
• Coordinates
  • Lat. (^o): 20.8222
  • Long. (^o): 63.5133
  • Depth (m): 17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102482	Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193183_10551222	F102482	N/A	MKLVVVLLLVGIVTVSCLPKRGKGGKGKRNRPCKENGEVDWDEGCVCQDESTCDSKDDCRENCGFKSGNPIVSCTCSDGEEWTKPEKPDKPETPCDGGRRWLKDVKSCTCDGETYEGKREMKRNCGRKGENAEECTCSDDSTWTPSEEDEEED