Scaffold Ga0192824_1062191

Overview

Basic Information

• Taxon OID: 3300018801
• Scaffold ID: Ga0192824_1062191
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 764
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas commoda (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_040
• Coordinates
  • Lat. (^o): 17.5294
  • Long. (^o): 67.9576
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003454	Metatranscriptome	485	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0192824_10621911	F003454	N/A	RQALIISMSLSLLPLAFIGSVSAHGGVVYPPIWQAGASIPLDEIVNDDAFTDPPARDPNSGRAVKNVKSWLTDQAYTGGIGDQFKKEGPITNDKSNKNLREWDRCRGNCMKYKNPWAAPGQAPTLGGGCGVFGGNPNGCPWGKDDRPAGSQCGQDEPLGRGGRGTSSFGTDARFYDFPDMITTEWEIGSVQEVAWSSKGGHRGGYTYRLCKMPKGGRTAITEDCFTKNVLEFATNFTMIKAIKNGKSEKGWEQF