Scaffold Ga0192839_1013541

Overview

Basic Information

• Taxon OID: 3300018777
• Scaffold ID: Ga0192839_1013541
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1158
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_052
• Coordinates
  • Lat. (^o): -16.9672
  • Long. (^o): 53.9337
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016768	Metatranscriptome	244	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0192839_10135412	F016768	N/A	GAYTKDVIVTPYGCRIKPCCLLLGLLALLPLLYYLLQPTCGGMVCNMFPAMCTECQITPPVGPLGECTLWGDPHIRTFDHIRSDYYSPGEFWIVKSKNVWIQGRYLPTKVTSGLGVTKAIAVGGPFLKGHKLFVTVRSATWDAQPVLTGFPSDFTVPGLVDMHYNNVGQLLQAGRSGKPLHIVHIKLEDGSPEGLQIQVNRWMEPTEGDYMNVKINMHKQPDQDGHCGNFNGIPTDDDRIQVRARVGKTGVEPAQMLFHTKTPVMVANRPNINDCPAEKLDDAKSVCKEKKQRETGSKWAIPSMDCLIDVCFGGKGFAQTG