Basic Information | |
---|---|
Taxon OID | 3300018753 Open in IMG/M |
Scaffold ID | Ga0193344_1028060 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789594-ERR1719358) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 820 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Pacific Ocean: TARA_110 | |||||||
Coordinates | Lat. (o) | -1.8155 | Long. (o) | -84.629 | Alt. (m) | Depth (m) | 50 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035620 | Metatranscriptome | 171 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193344_10280602 | F035620 | GAGG | MSYGGVIGRPGWSVVGSCLVVDKRRLSMSNMLVVDCSYRSCMVDLVVVMVGSDRGSDDGSLVASVAVADTGERASHSMGCVEVALRAGQGSQGGADKQDRLMTEHGCPSSN |
⦗Top⦘ |