Scaffold Ga0192902_1048149

Overview

Basic Information

• Taxon OID: 3300018752
• Scaffold ID: Ga0192902_1048149
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 795
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean: TARA_070
• Coordinates
  • Lat. (^o): -20.3943
  • Long. (^o): -3.2085
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021044	Metatranscriptome	220	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0192902_10481491	F021044	N/A	VPNVKMTSSTSSSGSDCSKYDCKIESGRVAKYDYDVKDSGSKSCAGKVAAPDLTQYVWDYKNDENKDLGLEVGAVVHNREWSYGLIKYASLVQIAVSFKARCTFSFRDEGTTRTLRIVDDTGYVHGELDINIHAGTPCVCAVPRKEKIAVKDKVIRCPQKLSNRKAGNCGEKLPTPSSSSQSIAEVNDGARVVVEKKYRADAAAMMEAGVEQVRKQVAAKYGASK