Scaffold Ga0193036_1035159

Overview

Basic Information

• Taxon OID: 3300018733
• Scaffold ID: Ga0193036_1035159
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 705
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_040
• Coordinates
  • Lat. (^o): 17.4831
  • Long. (^o): 68.0026
  • Depth (m): 105

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017783	Metatranscriptome	238	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193036_10351592	F017783	AGG	MFFLLFAVFLPSINALCLVQSCDKYWSTAKNDPNVKKACAVLFDENCCKATKPQYVVPKGESGKLCGVSGSLFSGSCKGPKLKDDVESLLVMPGCKLEVWDKGDGQEQAAKEEKKSANAGNLRDNKDRYNRNKLVFTASGKPHWVEELNDDFDDMDEDIESYRCTCN