Scaffold Ga0193529_1053552

Overview

Basic Information

• Taxon OID: 3300018731
• Scaffold ID: Ga0193529_1053552
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 734
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_151
• Coordinates
  • Lat. (^o): 36.1736
  • Long. (^o): -29.003
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014225	Metatranscriptome	264	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193529_10535521	F014225	N/A	LQHVERLDRNRDGTKRLNYAIVGPSELATVNKLLYATYHPYEPLTSHLGLCNGLNSMKDMDRMVESYLEKNLTLIAYDRGTGRPVGAAVNNSCHKDELSLSLQQELKDVGDASYHPIQAIHHQLRHENEHIFEEIGTNKMFSIKMIGIGEEDRGQGVATNLIRRSILLAGCLGFRAIKTEATGRFSKETFQRVGMQPAGSIKYDDFVFDGKKPFAGMKDGNSEITFMKKKFFQSSLKHIL