Scaffold Ga0194246_1057776

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194246_1057776

Scaffold Ga0194246_1057776

Overview

Basic Information
Taxon OID	3300018726 Open in IMG/M
Scaffold ID	Ga0194246_1057776 Open in IMG/M
Source Dataset Name	Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000618 (ERX1782150-ERR1711887)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	612
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029011	Metatranscriptome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194246_10577761	F029011	AGG	VSSTGFGFLTFDWVAPPVSDTSMESDFLHSFDVLSKFVVQVVTGHLAVFAVFPVSLSVQEPSWDFEVLWVGHNSLDLFHFGFSQLTGSFGSVDFGFFQDQVGESWTHTSDGGQSVGDLDVTIDVGILHSQNMLEILWVDEGHDVIFFYFFKLL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.