Scaffold Ga0194246_1025350

Overview

Basic Information

• Taxon OID: 3300018726
• Scaffold ID: Ga0194246_1025350
• Source Dataset Name: Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000618 (ERX1782150-ERR1711887)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 935
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025045	Metatranscriptome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194246_10253501	F025045	N/A	STQDENPMNNMIERVQDMYMAVLQSEECMERVACEVGGLAEDAGISKSLTRASEAFLPKKYNKMMKNFNHGKDCSKNNKCGLF