Scaffold Ga0193517_1050683

Overview

Basic Information

• Taxon OID: 3300018725
• Scaffold ID: Ga0193517_1050683
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 735
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Gulf of Mexico: TARA_142
• Coordinates
  • Lat. (^o): 25.6168
  • Long. (^o): -88.4532
  • Depth (m): 125

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083606	Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193517_10506831	F083606	N/A	VSTAVISNTQQDSSVDSLDLALRILTALVTKKEGVLDRLTAKSPRVEELPEGVDSLTDLQPAVPFAKLIARLIKLMRELKAEAHMSPDDEGSASSRIRGNLALFFAKVVEAQTDSEASPELKRLNFESLVDIFVDWLRKERGPVQQNIGVCLTRLSLNPQYRQRVRDLNGIESLHQIMLPKVEAQKAEASRLHRLRSERGLN