Scaffold Ga0193324_1014951

Overview

Basic Information

• Taxon OID: 3300018716
• Scaffold ID: Ga0193324_1014951
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 982
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_109
• Coordinates
  • Lat. (^o): 2.0299
  • Long. (^o): -84.5546
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060574	Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193324_10149511	F060574	N/A	VISGSWGISWGSLVWGWGLWVDSGSLIGDISDISIISVGRVLDVLDSAIRKSNGVRSSNVGSTIGLFLSIEAGLGVVISNSVGVGVWRDLIGVGLNISSLDWGMVSWGWGMISWGSVDSVGNNWGSVDDWGVDSVGNNWGSMDGMSNWGMDGVDSMGDNGISSVKSVGGISNNSSVGTESLALGGGSVFSLVWLADRLMADLSVSISIDWSVGTVVHWGNGSRDWGGEDWGMDSGMVSNSMVHQTEVGTGGGQNSAQTQESLHVYLYVL