Scaffold Ga0192984_1050177

Overview

Basic Information

• Taxon OID: 3300018710
• Scaffold ID: Ga0192984_1050177
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 816
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: TARA_085
• Coordinates
  • Lat. (^o): -62.0773
  • Long. (^o): -49.4534
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029760	Metatranscriptome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0192984_10501771	F029760	N/A	IEKGKESHEEWCHLLKTSMEDFKHEKSLGHQVQKYVPTIQNKYQALPASIENLFEKDVGKLVSNKLPGYQDSELRYLTFLYTCPLTVLFGAEQAGLASGPIEEAEKLTIHLVGARTAEIRHLVGWEIIALRLPKLRKLHVVFIGDEIISGAFPPTFTFKSNEAQKDKPDLQIKYTFEPPVLYQNYNKSPSYTKPDIIAALDCGFKFYPSWDPCIPQLVDQSGAPCVFTEFTLQDTKDNLTKVSKLVENVDVVIPPRRNPFCSRRPVRCSDTT