Scaffold Ga0193259_1031563

Overview

Basic Information

• Taxon OID: 3300018695
• Scaffold ID: Ga0193259_1031563
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789500-ERR1719457)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1085
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Pacific Ocean: TARA_092
• Coordinates
  • Lat. (^o): -33.688
  • Long. (^o): -71.9903
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042145	Metatranscriptome	158	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193259_10315633	F042145	AGGGGG	VFDDSTYNVKNIMTRTDSGKEKLTFAYLMNDLDFQKMQNLKSKVTAEDSLSSLFMPFVTGNFKLASQHVGTRASSWADFLDNQDASTNVVVFEPKNEQEFNQLYKKSEAYADNTERQVGYLVTAAKPRDLPLPQSPYQGVMFQEYPGTGIVNATTQFAGPQSVTPFTFQALIIVALVFFGTCIGNTCMSEIQVPITYLHKELPIRKEY