NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188851_1016040

Scaffold Ga0188851_1016040


Overview

Basic Information
Taxon OID3300018682 Open in IMG/M
Scaffold IDGa0188851_1016040 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)927
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)56.1664Long. (o)16.378218Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010918Metagenome / Metatranscriptome297Y
F017298Metagenome / Metatranscriptome241Y
F072337Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0188851_10160402F017298N/AMIEMIDNTYTYTTYSLKRKMLWWREQSIENDKGGSFNLELYLDYLEAQDEYLNPIKKDK
Ga0188851_10160403F010918N/AMRRFKVTYNYFDGGKKRIAVKILEALDRDHAIMLMAMWPKLILKVEQYEKI
Ga0188851_10160404F072337AGTAGMKKYRVWLEDSVEEKGGSWWNCYLGKDSKLHDYIYTDEQGDTLQWYIDNGYIVEEL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.