Scaffold Ga0188851_1002042

Overview

Basic Information

• Taxon OID: 3300018682
• Scaffold ID: Ga0188851_1002042
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3280
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 56.1664
  • Long. (^o): 16.378218
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004474	Metagenome / Metatranscriptome	436	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188851_10020422	F004474	N/A	MSTINYLLSVENLKKLGLIHSNTDAKLLSVAIKRSQDMQIQPALGTPLYKALLLRVETNTWTQDYLDLMNDYVVPCLVAFVDYRSALLLNEKLTNKAVGRLQDENLQPNTDSEQSAFRDQLRKDAYFYKERLIGYLMDDNSVKYPEYCEGCSDDCNENVQKDISGYQPINFIV