Scaffold Ga0193445_1046469

Overview

Basic Information

• Taxon OID: 3300018648
• Scaffold ID: Ga0193445_1046469
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 552
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Pacific Ocean: TARA_131
• Coordinates
  • Lat. (^o): 22.7267
  • Long. (^o): -157.9955
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003454	Metatranscriptome	485	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193445_10464691	F003454	N/A	AHGGVVYPPIWQAGASIPLDEIVNDDAFTDPPARDPNSGRAVKNVKSWLTDQAYTGGIGDQFKKEGPITNDKNNKNLREWDRCRGNCMKYKNPWAAPGQAPTLGGGCGVFGGNPNGCPWGKDDRPAGSQCGQDEPLGRGGRGTSSFGTDARFYDFPDMITTEWEIGSVQEVAWSSKGGHRGGY