Scaffold Ga0193292_1008754

Overview

Basic Information

• Taxon OID: 3300018594
• Scaffold ID: Ga0193292_1008754
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809463-ERR1739849)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 687
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_100
• Coordinates
  • Lat. (^o): -12.9723
  • Long. (^o): -96.0122
  • Depth (m): 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046820	Metatranscriptome	150	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193292_10087541	F046820	N/A	KRSAEPGYLGLGYGYGYGIGGVSRGVGLHPTGSVYESRSAQGLGKRSAEPGYLGYGLAPYGYAIGGVSTGVGLHPTGSVYESRSAQGLGKRSADAEPGYYTQNYWPSVVTPYGYSTCYGCRGKRSAEPGYLGLGYGYGYGIGGVSRGVGLHPTGSVYESRSAQGLGKRSAEPGYLGYGLAPNGYAIGGVSTGVGLHPTGSVYESRSAQGLGKRSADAEPGYYTQNYWP