Scaffold Ga0192844_1013587

Overview

Basic Information

• Taxon OID: 3300018593
• Scaffold ID: Ga0192844_1013587
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000600 (ERX1782171-ERR1712017)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 650
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_052
• Coordinates
  • Lat. (^o): -16.9534
  • Long. (^o): 53.9601
  • Depth (m): 75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044723	Metagenome / Metatranscriptome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0192844_10135871	F044723	N/A	TSKSMYASGQPALYMADKDSLPFLVDHYQRVATGPTSVFVHDLPYYRDTLDDAYMPSVWEKLQKPMLAFVDEHKARWGCDYLARPDGPPFITLDVRDKLEKLGLSNKGFRELSLRLGCPVLVDTGVLRIALTGFDKSKHDEVLPKILERLDFIMSLGPDDEIVTTFKQYNPFYASTGKSSKTVMG