NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188858_107562

Scaffold Ga0188858_107562


Overview

Basic Information
Taxon OID3300018567 Open in IMG/M
Scaffold IDGa0188858_107562 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dT
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)598
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)54.570232Long. (o)11.332183Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053729Metatranscriptome140N

Sequences

Protein IDFamilyRBSSequence
Ga0188858_1075621F053729N/ANRKGAEVMEEYRKDRGHWVSLTDGGMVDHMVDHIGANGFAVAGFFMTKHQGGKKEAYQNDMPGEEEQDSDEIFVAFKKMAKDQSWLSDIGLGHKTWTFGYGHKKDVAEQAGCTGVGTRAWDHVCIIVWKTSMDGTHMQTAHTTHFGLDFSKPDQVPGPDDIKKFIYRHTVASSKFSLEIHTYGLWKSGRKSINNKPRMR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.