Scaffold Ga0190270_11676152

Overview

Basic Information

• Taxon OID: 3300018469
• Scaffold ID: Ga0190270_11676152
• Source Dataset Name: Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 689
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location

• Location Name: USA: Utah
• Coordinates
  • Lat. (^o): 41.136
  • Long. (^o): -111.9047

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100608	Metagenome / Metatranscriptome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190270_116761521	F100608	N/A	HRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRWGRPPA