Scaffold Ga0190270_10184561

Overview

Basic Information

• Taxon OID: 3300018469
• Scaffold ID: Ga0190270_10184561
• Source Dataset Name: Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1742
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location

• Location Name: USA: Utah
• Coordinates
  • Lat. (^o): 41.136
  • Long. (^o): -111.9047

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046298	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190270_101845612	F046298	GGAG	MPGTLPHTQNGFAQIAAEQHFREQLDEETAGDPTTLKFDGKVAVSNEDAGSDPYNRTGRFQRLAR