NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066662_10623054

Scaffold Ga0066662_10623054


Overview

Basic Information
Taxon OID3300018468 Open in IMG/M
Scaffold IDGa0066662_10623054 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1014
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055862Metagenome / Metatranscriptome138Y
F072164Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0066662_106230541F055862AGAAGGMLSQTIGHKVSVSQLLPGVAVSLNARPYASYDIVVFSPTGEEPSELYAGLRAVGFTPSGPGTQPADVVRQSFGRDGSALLGGWTGPERERFIADARRTLRRFGFAFVPEVPFLKTTSR
Ga0066662_106230543F072164N/AVARRQQRRRPAFRLPRGATPDTTREQAAVDAGARRLMGLHDARSLESLVHDLRQLRDEADRNASDQPSPDALRAYRRATRELSEAERALVLIGAQG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.