NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190268_10328029

Scaffold Ga0190268_10328029


Overview

Basic Information
Taxon OID3300018466 Open in IMG/M
Scaffold IDGa0190268_10328029 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)938
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Arizona
CoordinatesLat. (o)33.5944Long. (o)-109.1397Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034242Metagenome / Metatranscriptome175N

Sequences

Protein IDFamilyRBSSequence
Ga0190268_103280292F034242AGGMGLIERHSSPERVQGRERGFEVQLGELGGFELRPTRLFLWPGSDRDAQARVLSLGRAPRSLLLPRKENEYVAGAVRMRSVGNPLMTLALAAVHTAKAVRRRESSDRG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.