Scaffold Ga0190269_10713991

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0190269_10713991

Scaffold Ga0190269_10713991

Overview

Basic Information
Taxon OID	3300018465 Open in IMG/M
Scaffold ID	Ga0190269_10713991 Open in IMG/M
Source Dataset Name	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	703
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location Name	USA: Arizona
Coordinates	Lat. (^o)	33.5944	Long. (^o)	-109.1397	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031612	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190269_107139912	F031612	AGGAGG	MFSATHDQLRLVKAIRAEQIAQAAISRRFETPAPSIRRAIGTRIVRFGTALAGEPSYSLARSR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.