Basic Information | |
---|---|
Taxon OID | 3300018432 Open in IMG/M |
Scaffold ID | Ga0190275_12852538 Open in IMG/M |
Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 559 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Montana | |||||||
Coordinates | Lat. (o) | 45.2639 | Long. (o) | -110.8632 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074526 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0190275_128525382 | F074526 | GGAGG | MFERMSLMLGRLFAELKREEGQGATEYAMVIGFLIVGLTIGLAALGVGIDAFLDRVAAELGTLIP |
⦗Top⦘ |