NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190275_10001969

Scaffold Ga0190275_10001969


Overview

Basic Information
Taxon OID3300018432 Open in IMG/M
Scaffold IDGa0190275_10001969 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14960
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (77.78%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Montana
CoordinatesLat. (o)45.2639Long. (o)-110.8632Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079676Metagenome / Metatranscriptome115Y
F081092Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0190275_1000196913F079676GGAMANSDTEIKVGDYVRARAGAYEGKVGTALRVVTTRDEGRTSESVLVSFPAGGADYLNVHELEKTEQAEE
Ga0190275_1000196914F081092GGCGGMTGYDDFIERLEGALEHEDGREDFLNYLQALTREQRAELVAEADRREPEVESN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.