Basic Information | |
---|---|
Taxon OID | 3300018430 Open in IMG/M |
Scaffold ID | Ga0187902_10335554 Open in IMG/M |
Source Dataset Name | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Bagasse, Gen0, Rep 2, Chloramphenicol |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1339 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.4148 | Long. (o) | -119.8405 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094637 | Metagenome | 105 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187902_103355541 | F094637 | AGGAG | MRISELENKLRKHAQTTKSVMQAPFDLNEEIKNMEVHTMSKPKITMKRTLAIAAVLSLCIITVTMTPLANSIKGFFSDIVRFDGAITGTKYENATNDIKFDVLELTSENGNVIIPLDLTFENPTEAPFPYIQEVAVSEYKIFDSNNKEIIKTKLSAEDGDKGTVSAGKVLVNLSLNDAKLKSGEEYTIVIEKMFGLSKADAPLHITGTWKCNFIR |
⦗Top⦘ |