NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190265_10465778

Scaffold Ga0190265_10465778


Overview

Basic Information
Taxon OID3300018422 Open in IMG/M
Scaffold IDGa0190265_10465778 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1372
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)37.9813Long. (o)-109.5168Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013869Metagenome / Metatranscriptome267Y
F016640Metagenome / Metatranscriptome245Y
F025222Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0190265_104657781F025222AGGAGGMIAFDAMEPEHMAFLYELYTRSAGDARQGVPYEALIDALGFDERVTKRIQRALEREGLVDLTAIPQMTTVSRPVMDRVRQQHHQQTIGMTLQGMRLMEDIFATRADTARPTPSTSPPA
Ga0190265_104657782F013869GGAGGMTIATVLAVYKTAPLVLVVESAEGAVCELSLADLHGAGHQLSDDACTSLVEDYQLFTCQSAAG
Ga0190265_104657783F016640N/AWRRWTDWRTPIRPLPSAEQSPQSRAFKAFTHGNSCLAAGQFADATAAFEQARALDPKRPYVAERLAEVARQQHTASTPAPVAAGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.