Scaffold Ga0181558_10355380

Overview

Basic Information

• Taxon OID: 3300018417
• Scaffold ID: Ga0181558_10355380
• Source Dataset Name: Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 786
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 31.972
  • Long. (^o): -81.028
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062175	Metagenome	131	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0181558_103553804	F062175	N/A	MTDKEAQAFMQKVDATAPFWVELHDEDRPTIQIQGSTVPRCLYNLMVTRRDVNLY