NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194138_10148069

Scaffold Ga0194138_10148069


Overview

Basic Information
Taxon OID3300018405 Open in IMG/M
Scaffold IDGa0194138_10148069 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T2_14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)964
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)41.2451Long. (o)-76.9856Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011383Metagenome / Metatranscriptome291Y
F012648Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0194138_101480692F012648GGAGMQQNITIKYIDGSETTYQVRPPDYAKWELTTKKVIAQFGGMWDILYVAHSAMKRDAGGKPVKPLDVWMESVADVEVGDESPKVIQEEA
Ga0194138_101480693F011383N/AEGTFALSMLADWGKANSVCEALWTAAESAPDTDISVTLTAATGAQFVFPIMPEFPTAGGAGTDAQTVDFTFKVSKGAVVETFS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.