Scaffold Ga0187770_10722416

Overview

Basic Information

• Taxon OID: 3300018090
• Scaffold ID: Ga0187770_10722416
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 795
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Colombia: Department of Meta
• Coordinates
  • Lat. (^o): 4.0627
  • Long. (^o): -73.195
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007929	Metagenome / Metatranscriptome	342	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187770_107224161	F007929	AGGGGG	VDASGYLYTIATVGMTFAGLSVLTMILRQMLGGQLTKWDSFVTRTWVQLGFMTTFGSILPPLLLLFGAPAPIAWRISSGAMAVILGGWALTFPRRRHAANPTRLPLQVVIFVLAMDVAALALAANAIVVPVERLAGVYGAAVTAILIGAGMLFPFASAFVHWYDALIGHEQPKS