NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184635_10083768

Scaffold Ga0184635_10083768


Overview

Basic Information
Taxon OID3300018072 Open in IMG/M
Scaffold IDGa0184635_10083768 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1252
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017022Metagenome243Y
F032948Metagenome / Metatranscriptome178N

Sequences

Protein IDFamilyRBSSequence
Ga0184635_100837681F032948AGGAGMAQLQQESPGRYVMKDLYLFNCKREILARKLEALPIKIPLKPIRPETALRRALTLNLDQKRYTSEESSFEKVNDKPVQNILSREALSNGDIDAGVGKAYVERGRIEVNTIYPEIRACLENGFRFHMETAITRDLSIVVTKYLTACMGIPVRPKNGEIYFALEKYIPEVLELMTVIDSLGQESTIRVSPVVGDEVQKVVERAHDHFRTSVETLVRLTAEISDETHTKTLNTRLKDARDLLEQAAAYEIGL
Ga0184635_100837682F017022GAGGMMTLQHQDCEECRLNVEIISVNGNLISKQILQGMEKSGEQVAVHVNRQGKLLSVMTIKTADVPETLSLDHEFEARYSEYLKDLKTGESLIMMTTEGSDHVGIYKLPPRPLH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.