Basic Information | |
---|---|
Taxon OID | 3300018056 Open in IMG/M |
Scaffold ID | Ga0184623_10193173 Open in IMG/M |
Source Dataset Name | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 937 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: East River, Colorado | |||||||
Coordinates | Lat. (o) | 38.9195 | Long. (o) | -106.9496 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014009 | Metagenome / Metatranscriptome | 266 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0184623_101931732 | F014009 | N/A | CRHCGAETDARFRFCPWCAKPQRRKLVEFFGGADQDAGSALRVSRYLPEQRVRFSIWDESGTARAAVSLDEEEAARLAAYLAPPPQPKTRLLDDLRALVRR |
⦗Top⦘ |