NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184634_10048578

Scaffold Ga0184634_10048578


Overview

Basic Information
Taxon OID3300018031 Open in IMG/M
Scaffold IDGa0184634_10048578 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1747
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013143Metagenome / Metatranscriptome274Y
F051769Metagenome / Metatranscriptome143Y
F095084Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0184634_100485782F051769N/AMNACAASGRVAAAVLLAMGGLGLGLFLLGGRRATPLPVVRCPIHGIAYDAELEVCPDCAKTDAAGGKGGAR
Ga0184634_100485783F095084GGAGGMSGMPALYCRTCNTFREIEDWRERGEALVIALEPCGNKIRRRAGIEWPIHTVAA
Ga0184634_100485784F013143AGGAGMLSRFVLGAIVGGIAVYLWGDEIRRFANTKSRTARLAAADTLKAVQSTAEEMFDSAKDQVTSTLQSGQDAIRPARANRDR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.