NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187815_10018085

Scaffold Ga0187815_10018085


Overview

Basic Information
Taxon OID3300018001 Open in IMG/M
Scaffold IDGa0187815_10018085 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3041
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004823Metagenome / Metatranscriptome422Y
F006278Metagenome / Metatranscriptome377Y
F006399Metagenome / Metatranscriptome374Y
F015384Metagenome / Metatranscriptome255Y

Sequences

Protein IDFamilyRBSSequence
Ga0187815_100180851F015384AGGAGMSWFHSSTAAVDARNYVSPAEIVACFQGQRNVLRRLAFLITDDQTTADQAVDQACKMTLQRNSPFRDWLFEWAKAATITSAISHGTKALRTCEAAHKDRRCPHVEHLS
Ga0187815_100180852F006278GAGGMFRAEIQWIASGPTLKLEGKLVADWAEQARCLVTKDVLPKGLIVDLTEVSYIDSVGEQLLKWLASVGALFVAGNVYAIAVCDRLGLSPMQRISERRKRRHGNHEERSSIRHFHPVEAI
Ga0187815_100180853F006399AGGMATSALNSRVQSLVTEYGVFWQCWPQFEQTRGERRLVGFEVELIGSHTSDLNHVDPACPTCRHVRSGLLAIADLMPGELTLCRNSLTYNIDSHSNSIVCLPALGNRSAVWVSIYVFLNRANGQSFETDLLNEVKTLLNRWGIHQR
Ga0187815_100180855F004823AGGAGMYATKAIKGVPAIQRDGQSVLRVCDQDWEFANWLCALLNELGQKSELLLNEQDWEWLKAIDSPFRRTVQHA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.