Scaffold Ga0187815_10017098

Overview

Basic Information

• Taxon OID: 3300018001
• Scaffold ID: Ga0187815_10017098
• Source Dataset Name: Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3139
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9061
  • Long. (^o): -76.1569
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006811	Metagenome	364	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187815_100170984	F006811	N/A	MDRTDAIRLLETLVAAGMNTRAPRANAWIEKKALQIGLEGNQFVSALAYAGNEGWLADAPRKGWTSLTRAGEAIARR