Scaffold Ga0180436_11408115

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180436_11408115

Scaffold Ga0180436_11408115

Overview

Basic Information
Taxon OID	3300017990 Open in IMG/M
Scaffold ID	Ga0180436_11408115 Open in IMG/M
Source Dataset Name	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	536
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	33.3	Long. (^o)	-115.8	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054793	Metagenome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180436_114081152	F054793	N/A	MHVYTLTQFNASECYEEPRVIGYYASKRKADAKSVELSVRQAKEEEEDWITNPCECGDRNCERRDHFRNEWSVEKFDLTELSMRQLMKIELADADQD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.