Scaffold Ga0180436_10253289

Overview

Basic Information

• Taxon OID: 3300017990
• Scaffold ID: Ga0180436_10253289
• Source Dataset Name: Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1278
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.3
  • Long. (^o): -115.8
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084255	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180436_102532892	F084255	N/A	MESSKRYLLQAEIEYWHEMLRLNRSRLTKNKEEEMRACLKKAVRSLNSSAYGELRAAA