Scaffold Ga0187782_10125029

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187782_10125029

Scaffold Ga0187782_10125029

Overview

Basic Information
Taxon OID	3300017975 Open in IMG/M
Scaffold ID	Ga0187782_10125029 Open in IMG/M
Source Dataset Name	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1903
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location Name	Colombia: Department of Meta
Coordinates	Lat. (^o)	4.0627	Long. (^o)	-73.195	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082035	Metagenome / Metatranscriptome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0187782_101250293	F082035	N/A	GVNVQYMRVPAEKTVSAFLDDYAKNNNGTVAARQQLDLQGRKVEDVLMKTTDDSLGPMINRVMAFRRGDIVFISTAWSIEEKYEKYKKIFATVLASFNPTGN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.